reversed-phase HPLC is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Updated 2025-08-09. Numbers and descriptions here follow the published literature rather than marketing material.
Dissolution is usually performed in water or a suitable aqueous buffer, and the resulting liquid is divided into single-use portions before freezing. Freeze-thaw cycling is a recognised source of loss for short peptides, since each cycle can encourage aggregation or adsorption onto container walls. Working solutions are generally kept cold and used within a short window, although published stability data specific to epitalon are thin. Containers should be marked with concentration and date, and solutions examined for cloudiness before use.
Identity is normally established by reversed-phase high-performance liquid chromatography combined with mass spectrometry, a pairing that separates components and confirms molecular mass at once. Purity is quoted as a percentage from the chromatogram, and figures above ninety-five percent are a frequent commercial specification. Amino acid analysis or sequencing supplies further confirmation when required. Because many short peptides behave similarly under chromatography, retention time alone does not establish sequence; the mass measurement is what separates one tetrapeptide from another, and certificates should report both.
Human data are limited to small studies, often without the randomization, blinding, or control groups expected in contemporary clinical research. Reported outcomes have included changes in melatonin levels, immune markers, and subjective measures, but sample sizes were generally too small to support firm conclusions. Some reviews treat the peptide as promising while noting methodological weaknesses; others question whether the observed effects are specific. The compound is frequently discussed in longevity-focused communities, where enthusiasm often outpaces the published evidence. Separating established findings from speculation is therefore important when reading summaries of this research.
Epitalon emerged from research conducted in Saint Petersburg by Vladimir Khavinson and colleagues, who studied short peptides as potential regulators of aging. The work built on epithalamin, a pineal gland extract reported to influence neuroendocrine function. Epitalon was designed as a synthetic counterpart with a defined sequence, allowing reproducible experiments that extracts could not support. Early publications described effects on melatonin rhythms and lifespan in animal models. These findings circulated mainly in Russian-language journals during the 1990s, which limited their visibility among English-speaking researchers.
| Property | Value | Notes |
|---|---|---|
| Sequence | Ala-Glu-Asp-Gly | Written in three-letter amino acid code |
| Single-letter code | AEDG | Form used in most catalogue entries |
| Typical purity specification | 95 percent or higher | Value read from the HPLC chromatogram |
| Storage, dry solid | Minus 20 degrees Celsius, desiccated | Sealed container, protected from light |
| Handling, solution | Divide into single-use portions | Limits losses from freeze-thaw cycling |
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography with ultraviolet detection, frequently near 214 nanometers where the peptide bond absorbs. Mass spectrometry, most often with electrospray ionization, confirms the observed molecular mass and helps separate the intact peptide from truncated or modified forms. Amino acid analysis or tandem mass spectrometry can establish residue order. Purity is commonly quoted as an area percentage, yet such values are method-dependent, and comparisons between laboratories require matching column, gradient and detection wavelength.
Laboratory handling begins with dissolution of the lyophilized powder in water or a suitable aqueous buffer. The dry solid is the more stable form, so stock solutions are generally prepared only when required and kept cold afterwards. Repeated freezing and thawing of a solution is avoided because it encourages aggregation and gradual loss of the intact chain. Diluents and containers are selected to limit adsorption of a short peptide onto plastic surfaces and to reduce microbial growth in aqueous preparations.
Identity confirmation uses mass spectrometry, usually electrospray ionisation in positive mode or matrix-assisted laser desorption. The protonated free peptide produces a signal near three hundred and ninety-one daltons, while salt adducts shift that value slightly. Tandem mass spectrometry or amino acid analysis supplies sequence-level confirmation, which a single mass measurement cannot. Peptides containing aspartate can cyclise into succinimide intermediates that hydrolyse to isoaspartate isomers of identical mass. Because those isomers are difficult to separate chromatographically, identity and purity results carry more weight when interpreted together.
Storage practice centres on limiting moisture, oxygen, and repeated temperature cycling. Freeze-dried powder is generally held desiccated at minus twenty degrees Celsius or colder and protected from light. Reconstituted solutions are markedly less stable, and the aspartate-glycine junction is prone to succinimide formation at neutral to mildly alkaline pH. Portioning material into single-use aliquots reduces degradation compared with repeated freeze-thaw cycles. Stability data specific to this tetrapeptide remain scarce, so most handling guidance is extrapolated from general peptide chemistry rather than measured directly.
Documentation accompanying research peptides usually includes a certificate of analysis listing the batch number, purity figure, and test methods applied. Buyers comparing suppliers should check whether the reported purity refers to chromatographic area or to a mass-balance calculation, because the two are not equivalent. Counter-ion content, residual solvents, and water content are sometimes omitted from such certificates even though they affect the actual peptide mass present. Independent verification through a second laboratory is the most direct way to confirm that a supplied material matches its label.
Epitalon appears in the literature primarily through a small number of research groups, most of them associated with the St. Petersburg Institute of Bioregulation and Gerontology. Publications describe cell culture experiments, animal studies, and a limited number of small human studies. Independent replication outside this network is sparse. As a result, reviews of the topic usually separate descriptive reports of observed effects from the question of whether those effects generalize, and they note the difficulty of comparing studies that use different preparations and endpoints.
Analytical characterization of epitalon relies on standard peptide methods. Reverse-phase high-performance liquid chromatography is used to assess purity, and mass spectrometry confirms identity by checking the observed mass against the expected value near 390 daltons. Amino acid analysis can verify composition. Because the peptide is short and hydrophilic, it elutes early on many reverse-phase columns, so method development often requires ion-pairing reagents to achieve adequate retention and resolution from related impurities.
=== Visual effects === Zoic Studios provided visual effects for the series. According to Johns, Stargirl was the first Warner Bros. Television series to use previsualization (a process most commonly used by feature films) for their effects scenes. Previsualization was handled by The Third Floor, Inc. Johns brought his experience working on the films Wonder Woman (2017), Aquaman (2018), and Shazam! (2019) to help the series have visuals not "seen in superhero shows before".
In August 2015, Arby's introduced a series of five small sandwiches called Sliders starting at $1.29, with prices varied by location. These new menu items led to an increase in sales at many locations. This is not the first time Arby's tried to market miniature sandwiches. Two years earlier, Arby's tried to sell a similar product called the Mighty Minis that were sold in pairs. During the first month of national sales, the firm was able to sell 1 million or a ton of sliders. To encourage additional sales outside normal lunch and dinner meal hours, began to offer sliders and small size drinks and sides at the reduced price of $1 between the hours of 2 and 5 p.m. starting in October 2015. Due to Arby's great success in the increase of sales created by the introduction of this new product line, Nation's Restaurant News awarded Arby's its MenuMasters Award for 2016. The Turkey 'n Cheese was initially offered as a limited time menu item in December 2016 but was shown to be popular enough to be retained on the regular menu. A Pizza Slider was introduced as a limited time menu item in May 2017. In late August 2016, Arby's introduced four chicken sandwiches that used a buttermilk-based breaded breast filet. Arby's debuted a new sandwich known as Smokehouse Pork Belly Sandwich in October 2016.
=== Bio-Chemicals business === Biosimilars Monoclonal Antibodies Amino acids, nucleic acids and related compounds, health care products and other active pharmaceutical ingredients Vitamins, minerals, peptides and plant growth regulators
In competitive sports, doping is the use of banned athletic performance-enhancing drugs (PEDs) by athletes as a way of cheating. As stated in the World Anti-Doping Code by WADA, doping is defined as the occurrence of one or more of the anti-doping rule violations outlined in Article 2.1 through Article 2.11 of the Code. The term doping is widely used by organizations that regulate sporting competitions. The use of drugs to enhance performance is considered unethical and is prohibited by most international sports organizations, including the International Olympic Committee. Furthermore, athletes (or athletic programs) taking explicit measures to evade detection exacerbate the ethical violation with overt deception and cheating. The origins of doping in sports go back to the creation of the sport itself. From ancient usage of substances in chariot racing to more recent controversies in doping in baseball, doping in tennis, doping at the Olympic Games, and doping at the Tour de France, popular views among athletes have varied widely from country to country over the years. The general trend among authorities and sporting organizations over the past several decades has been to regulate the use of drugs in sports strictly. The reasons for the ban are mainly the health risks of performance-enhancing drugs, the equality of opportunity for athletes, and the exemplary effect of drug-free sports for the public. Anti-doping authorities state that using performance-enhancing drugs goes against the "spirit of sport".
Through additional reactions the nitrogen is incorporated into glutamine and glutamate and eventually used in the synthesis of other amino acids and nitrogenous compounds. After harvest, the majority (around 80%) of available nitrogenous compounds found in the grapes are concentrated in the skins and seeds. These compounds get released into the must during the process of crushing and during maceration/skin contact. Even after pressing up to 80% of initial nitrogen content within each grape berry will be left behind in the pomace.
Sources: en.wikipedia.org
Just like the GT-X, the engine power of the European market GT-R was also lowered to produce 185 PS (136 kW; 182 hp). As per the first GT-X, 300 units special version of GT-R were produced known as GT-Ae. These shared the power output of the GT-R, but were 30 kg (66 lb) lighter, fitted with closer ratio gearboxes, and featured a larger top spoiler with a gap between the hatch and the spoiler to direct air to the new lower spoiler. The wiring for ABS, air conditioning, power mirrors, power windows, power locks, and sunroof was removed. Instead of using the GT-R's leather interior, the lighter cloth interior of the GT-X was used.
Mahmoud Reza Banki (Persian: محمودرضا بانکی; born 1976) is an Iranian-American scientist, management consultant and business executive. Born in Tehran, Iran, Banki immigrated to the US to attend college and became a naturalized US citizen in the 1990s. In January 2010, Banki was arrested and charged with violating US sanctions against Iran by the United States Attorney's office in New York City. Ultimately Banki won his case on appeal, and it was permanently closed in July 2012. Banki spoke about his case at a TED Talk in 2014, presenting a case for change in criminal justice. As of 2015 a documentary film about the case was being made. In The Moth podcast released January 2017, Banki spoke to the personal toll of the ordeal. Banki has also spoken before various audiences for the cause of improving the criminal justice system. As of 2022, Banki was Chief Financial Officer and Chief Strategy Officer at leading streaming company Tubi. On January 20, 2021, Banki received a full and unconditional pardon from the President of the United States. He was the CFO of X Corp. between November 2024 and October 2025.
Ovarian cysts such as in polyendocrine metabolic ovarian syndrome (PMOS), the most common cause in women. Adrenal gland tumors, adrenocortical adenomas, and adrenocortical carcinoma, as well as adrenal hyperplasia due to pituitary adenomas (as in Cushing's disease). Inborn errors of steroid metabolism such as in congenital adrenal hyperplasia, most commonly caused by 21-hydroxylase deficiency. Acromegaly and gigantism (growth hormone and IGF-1 excess), usually due to pituitary tumors.
=== EC 1.17.98 With other, known, physiological acceptors === EC 1.17.98.1: bile-acid 7α-dehydroxylase. Now known to be catalyzed by multiple enzymes. EC 1.17.98.2: bacteriochlorophyllide c C-71-hydroxylase EC 1.17.98.3: formate dehydrogenase (coenzyme F420) EC 1.17.98.4: formate dehydrogenase (hydrogenase)
=== Perkin-Elmer === In February 1993 Applied Biosystems was acquired by Perkin-Elmer, and became the Applied Biosystems Division, as part of the Life Sciences markets segment of that company. Andre Marion, who had been Applied Biosystems's Chairman, president and CEO, became a Senior Vice President of Perkin-Elmer, and President of the Applied Biosystems Division. That year the company was the world's leading manufacturer of instruments and reagents for polymerase chain reaction (PCR). It marketed PCR reagents kits in alliance with Hoffman-La Roche Inc. In 1994, Perkin-Elmer reported net revenues of over $1 billion, of which Life Sciences accounted for 42% of the business. The company has 5,954 employees. A brand-new highly competitive genomics industry had formed for the development of new pharmaceuticals, based on the work of the Human Genome Project. Companies such as Sequana Therapeutics in San Diego, Human Genome Sciences in Maryland, Myriad Genetics in Utah, INCYTE Pharmaceuticals (later Incyte Genomics) in California, and Millennium Pharmaceuticals relied on the Applied Biosystems Division, which made thermal cyclers and automated sequencers for these new genomics companies. In 1995, upon Andre Marion retirement, Mike Hunkapiller became President of PE Applied Biosystems Division which sold its 30,000th thermal cycler. To meet Human Genome Project goals, Perkin-Elmer developed mapping kits with markers every 10 million bases along each chromosome. Also that year, DNA fingerprinting using PCR became accepted in court as reliable forensic evidence.
Sources: en.wikipedia.org
Cathelicidin antimicrobial peptide (CAMP) is an antimicrobial peptide encoded in the human by the CAMP gene. The active form is LL-37, a 37 amino acid peptide having sequence [LL-37, 37 aa] In humans, CAMP encodes the peptide precursor CAP-18 (18 kDa), which is processed by proteinase 3-mediated extracellular cleavage into the active form LL-37. The cathelicidin family includes 30 types of which LL-37 is the only cathelicidin in the human. Cathelicidins are stored in the secretory granules of neutrophils and macrophages and can be released following activation by leukocytes. Cathelicidin peptides are dual-natured molecules called amphiphiles: one end of the molecule is attracted to water and repelled by fats and proteins, and the other end is attracted to fat and proteins and repelled by water. Members of this family react to pathogens by disintegrating, damaging, or puncturing cell membranes. Cathelicidins thus serve a critical role in mammalian innate immune defense against invasive bacterial infection. The cathelicidin family of peptides are classified as antimicrobial peptides (AMPs). The AMP family also includes the defensins. Whilst the defensins share common structural features, cathelicidin-related peptides are highly heterogeneous. Members of the cathelicidin family of antimicrobial polypeptides are characterized by a highly conserved region (cathelin domain) and a highly variable cathelicidin peptide domain. Cathelicidin peptides have been isolated from many different species of mammals, including marsupials.
Phillips and Connelly had an agreement that distribution of MET-Rx would be controlled, and that they would not sell it to retail outlets in order to keep supply low during the period of high demand created by the advertisements in Muscle Media 2000. Connelly however, had other ideas and began selling it to mainstream distributors and department stores. Phillips believed this move lessened its appeal to bodybuilders, and destroyed the "mystique" of the product. The two parted ways, and as part of the settlement, Phillips was legally bound not to mention the name of MET-Rx in his magazines (thereafter he would refer to it as "the leading brand"). But by then Phillips had his eye on another venture that would eclipse MET-Rx altogether – EAS.
Camellia sinensis is an evergreen plant that grows mainly in tropical and subtropical climates. Some varieties can tolerate oceanic climates and are cultivated as far north as Cornwall in England, Perthshire in Scotland, Washington in the United States, and Vancouver Island in Canada. In the Southern Hemisphere, tea is grown as far south as Hobart in Tasmania and Waikato in New Zealand. Tea plants are propagated from seed and cuttings; about 4 to 12 years are needed for a plant to bear seed and about three years before a new plant is ready for harvesting. In addition to a zone 8 climate or warmer, tea plants require at least 1,200 millimetres (47 in) of rainfall per year and prefer acidic soils. Many high-quality tea plants are cultivated at elevations of up to 2,000 metres (6,600 ft) above sea level. Though at these heights the plants grow more slowly, they acquire a better flavour.
SQM commissioned a life-cycle analysis (LCA) which concluded that water consumption for SQM's lithium hydroxide and carbonate is significantly lower than the average consumption by production from the main ore-based process, using spodumene. A more general LCA suggests the opposite for extraction from reservoirs. The majority of brine based production is in the "lithium triangle" in South America.
Sources: en.wikipedia.org
Reversed-phase high-performance liquid chromatography is run alongside mass spectrometry. The chromatogram separates components and gives a purity figure, while the mass spectrum confirms that the measured molecular mass matches the expected sequence. Neither measurement on its own is treated as sufficient.
Long-term holding is usually at minus twenty degrees Celsius in a sealed, desiccated container. A refrigerator is adequate for short intervals before use. Light exposure is normally avoided as well. Allowing a cold container to warm before opening reduces moisture condensation on the contents.
Repeated cycles are generally avoided. Each freeze and thaw can promote aggregation or loss of peptide to container surfaces, which reduces the amount available for later work. Dividing a solution into single-use portions at the outset is the usual way to limit this problem.
Vladimir Khavinson and colleagues at research institutes in Saint Petersburg developed and studied the peptide. Their program examined short peptides as regulators of aging and neuroendocrine function. Epitalon was one of several compounds produced by that group.