Everything below concerns anti-doping. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Updated 2025-10-28. Numbers and descriptions here follow the published literature rather than marketing material.
AOD-9604 has been investigated mainly in the context of body fat and metabolic endpoints. Some early animal and small human studies reported changes in fat mass or lipid markers, but findings were not uniform. Larger, well-controlled trials that would establish efficacy are lacking in the public literature. As a result, claims about weight loss or metabolic benefit remain investigational rather than established. The distinction between a research finding and a proven clinical outcome is central to discussing this peptide.
Regulatory bodies have taken different approaches to AOD-9604. It is not approved as a prescription medicine by major agencies such as the U.S. Food and Drug Administration or the European Medicines Agency. In sport, the World Anti-Doping Agency prohibits peptide hormones, growth factors, and related substances, and AOD-9604 has been treated as a prohibited substance. These regulatory decisions reflect concerns about safety, efficacy, and potential misuse rather than proof of benefit.
Research on AOD-9604 also examines how the peptide is measured in biological samples. Analytical methods may include liquid chromatography coupled with mass spectrometry, immunoassays, or both. Detection can be challenging because the peptide is small and may be present at low concentrations. Published methods vary in sensitivity and specificity, so comparative interpretation requires attention to validation details. The presence of related hGH fragments can complicate identification in some matrices.
AOD-9604 is a synthetic peptide whose sequence matches the C-terminal fragment of human growth hormone, specifically residues 176 through 191. This region differs from the full hormone in its receptor interactions. The peptide is not a growth hormone secretagogue and does not bind the growth hormone receptor in the same manner. Researchers have examined it for effects on lipid metabolism, but its exact pharmacological profile remains an active area of study.
Development of AOD-9604 began in the 1990s as scientists sought to isolate metabolic effects of growth hormone without its growth-promoting actions. Early laboratory work focused on fat cells and animal models. Several human trials followed, examining changes in body composition and fat mass. Results have been mixed, and the peptide has not progressed to widespread clinical approval. Interest continues in research settings, particularly regarding its mechanism and potential metabolic targets.
Regulatory status varies by country. In the United States, AOD-9604 is not approved as a prescription drug. It is sometimes sold as a research chemical or dietary supplement, though such marketing may fall outside legal frameworks. The World Anti-Doping Agency prohibits its use in sport. Researchers must obtain it through legitimate suppliers and follow institutional rules. Its legal classification continues to evolve as authorities increasingly assess peptide products more broadly.
| Property | Value | Notes |
|---|---|---|
| Regulatory status | Not approved as a medicine | Major agencies have not authorized it for therapeutic use. |
| Anti-doping status | Prohibited in sport | Listed among peptide hormones and related substances. |
| Primary research area | Metabolic and body-composition effects | Studies often examine fat mass or lipid markers. |
| Human evidence | Limited and mixed | Public data do not establish clinical efficacy. |
| Analytical detection | LC-MS and immunoassays | Methods vary in sensitivity and validation. |
The compound has been studied as a potential treatment for obesity and related metabolic conditions. Published trials have examined changes in body weight, fat mass, and safety markers over limited durations. Results have been mixed or modest, and no large-scale outcome trials are established. Regulatory agencies in several countries have not approved it as a therapeutic drug. Some commercial products have been marketed outside regulated pharmaceutical channels, which raises questions about quality and claims.
In the scientific literature, AOD-9604 appears in reviews of growth hormone fragments and in discussions of peptide-based metabolic research. Some sources distinguish it from growth hormone itself, while others group it with compounds marketed for weight management. The evidence base is small compared with approved obesity medications. Questions about long-term efficacy and clinical relevance remain open, and independent replication of key findings is limited. Most published reports are early-stage and exploratory.
AOD-9604 is prohibited in sport by the World Anti-Doping Agency under the peptide hormone class. Its presence in a sample can be detected through mass spectrometry-based methods, although the exact assay depends on the laboratory. In research settings, material is often supplied as a lyophilized powder for reconstitution. Buyers and researchers should note that products labeled AOD-9604 may vary in purity and actual peptide content. Analytical certificates and independent testing are common ways to verify identity, but no global harmonized standard exists for all commercial lots.
AOD-9604 is a synthetic peptide whose sequence is modeled on the C-terminal region of human growth hormone. Published descriptions commonly place it as a modified fragment corresponding to hGH amino acids 176–191, with a tyrosine residue added or retained at the N-terminus to support detection and handling. It is not intact growth hormone and lacks the full receptor-binding architecture of the parent protein. The molecule was developed as a research candidate for metabolic studies rather than as a replacement for growth hormone therapy. Its identity is defined by its amino acid sequence rather than by any single commercial preparation.
AOD-9604 drew attention in the 1990s and 2000s as a potential anti-obesity agent. Early work explored both injectable and oral routes, which is unusual for a peptide of this size. Animal studies reported changes in fat metabolism without the growth-promoting or insulin-like effects associated with full-length growth hormone. Subsequent human trials produced mixed or modest results, and the compound did not obtain regulatory approval for weight management in major markets. It remains known mainly through research literature, sports anti-doping listings, and non-approved supplement advertising.
White was married to his wife Edna for more than 40 years. He died unexpectedly on February 14, 1980, in Santa Barbara, California, where he had gone that day from his home in Palo Alto to deliver a lecture at the University of California. Several awards in the field of biochemistry have been named for White, including at Oakland University in Michigan, Wayne State University, George Washington University School of Medicine and the Gladstone Institutes. 1935 – Traveling Fellowship, American Physiological Society, for the XVth International Congress of Physiology (Leningrad and Moscow) 1938 – Eli Lilly Prize in Biochemistry 1960 – Distinguished Alumni Award, University of Denver 1967 – Sesquicentennial Alumni Award, University of Michigan 1969 – Borden Award, Association of American Medical Colleges 1959 – Doctor of Humane Letters, Yeshiva University 1975 – Doctor of Science, University of Denver
On 1 March, the Department of Food and Veterinary of Lithuania announced that horse meat was found in three canned beef brands sold by Latvian company Kuršu Zeme. Canned beef made by the Latvian company was removed from sale in Lithuania. === Wiljo Import en Export B.V. and Vleesgroothandel Willy Selten B.V. === On 10 April 2013, it was reported that two Dutch trading companies, owned by the same person whom food safety officials had previously investigated, may have supplied 50,000 metric tonnes of adulterated beef containing horse meat since January 2011. On 7 February 2013, it was revealed by the Food Standards Agency that the Findus beef lasagne range in the UK, France, Norway, and Sweden, and the shepherd's pie and moussaka ranges in France, contained horse meat without proper declaration or official scrutiny. The contamination may have gone on since summer 2012 according to a leaked document.
The tertiary structure and topology of TMEM125 was predicted and visualized through Phyre2. TMEM125 has 1 predicted phosphorylation site (CK2 Phos), 5 predicted N-myristoylation sites (N-myr), 2 predicted palmitoylation sites (Pal), and 1 predicted amidation site (Amid). It also contains the domain of unknown function 66 (DUF66). TMEM125 is predicted to be subcellularly localized in the plasma membrane. It is secondarily predicted to be localized in the endoplasmic reticulum. There were no scientifically-verified protein interactions identified for TMEM125. String Protein Interaction predicted 10 functional protein partners for TMEM125, but all were determined through textmining. TMEM125 is conserved in species as distantly related to humans as cartilaginous fish, that’s most recent common ancestor to humans existed 465 million years ago. TMEM125 is highly conserved in primates, mammals, birds, reptiles, bony fish, and cartilaginous fish, but is not observed in invertebrates. TMEM125 does not have any paralogs.
Sources: en.wikipedia.org
Quantitative studies of enzymatic reactions often found that the acceleration of chemical reaction speed cannot be fully explained by existing theories like the approximation, acid/base catalysis and electrophile/nucleophile catalysis. And there is an obvious paradox: in reversible enzymatic reaction if the active site perfectly fits the substrates then the backward reaction will be slowed since products cannot fit perfectly into the active site. So conformational distortion was introduced and argues that both active site and substrate can undergo conformational changes to fit with each other all the time.
The cell membrane can form different types of "supramembrane" structures such as caveolae, postsynaptic densities, podosomes, invadopodia, focal adhesions, and different types of cell junction. These structures are usually responsible for cell adhesion, communication, endocytosis and exocytosis. They are composed of specific proteins, such as integrins and cadherins. They can be visualized by electron microscopy or fluorescence microscopy.
Agouti-signaling protein is a protein that in humans is encoded by the ASIP gene. It is responsible for the distribution of melanin pigment in mammals. Agouti interacts with the melanocortin 1 receptor to determine whether the melanocyte (pigment cell) produces phaeomelanin (a red to yellow pigment), or eumelanin (a brown to black pigment). This interaction is responsible for making distinct light and dark bands in the hairs of animals such as the agouti, which the gene is named after. In other species such as horses, agouti signalling is responsible for determining which parts of the body will be red or black. Mice with wildtype agouti will be grey-brown, with each hair being partly yellow and partly black. Loss of function mutations in mice and other species cause black fur coloration, while mutations causing expression throughout the whole body in mice cause yellow fur and obesity. The agouti-signaling protein (ASIP) is a competitive antagonist with alpha-Melanocyte-stimulating hormone (α-MSH) to bind with melanocortin 1 receptor (MC1R) proteins. Activation by α-MSH causes production of the darker eumelanin, while activation by ASIP causes production of the redder phaeomelanin. This means where and while agouti is being expressed, the part of the hair that is growing will come out yellow rather than black.
The NDUFB4 gene, located on the q arm of chromosome 3 in position 13.33, is 6,130 base pairs long. The NDUFB4 protein weighs 15 kDa and is composed of 129 amino acids. NDUFB4 is a subunit of the enzyme NADH dehydrogenase (ubiquinone), the largest of the respiratory complexes. The structure is L-shaped with a long, hydrophobic transmembrane domain and a hydrophilic domain for the peripheral arm that includes all the known redox centers and the NADH binding site. NDUFB4 is one of about 31 hydrophobic subunits that form the transmembrane region of Complex I and is of the non-catalytic subunits of the complex. It has been noted that the N-terminal hydrophobic domain has the potential to be folded into an alpha helix spanning the inner mitochondrial membrane with a C-terminal hydrophilic domain interacting with globular subunits of Complex I. The highly conserved two-domain structure suggests that this feature is critical for the protein function and that the hydrophobic domain acts as an anchor for the NADH dehydrogenase (ubiquinone) complex at the inner mitochondrial membrane.
Sources: en.wikipedia.org
Biopharmaceuticals may be produced from microbial cells (e.g., recombinant E. coli or yeast cultures), mammalian cell lines (see Cell culture) and plant cell cultures (see Plant tissue culture) and moss plants in bioreactors of various configurations, including photo-bioreactors. Important issues of concern are cost of production (low-volume, high-purity products are desirable) and microbial contamination (by bacteria, viruses, mycoplasma). Alternative platforms of production which are being tested include whole plants (plant-made pharmaceuticals).
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Potency is the amount of drug needed to give a certain therapeutic effect. It is affected by the drug's affinity to the receptors and the number of receptors available. For antagonists, half maximal inhibitory concentration (IC50) is used to measure the potency of antagonists. IC50 means the concentration of antagonist needed to give a 50% inhibition. It can be directly compared with EC50, which is commonly used to measure the potency of an agonist. EC50 means the concentration of agonist needed to give a 50% response. IC50 is significant in determining the optimal dose of antagonist. A high concentration of an antagonist in the body may result in toxicity in the cell and damage the cell membrane. A lower IC50 means the inhibitory effect can be met with a lower concentration of antagonist and, therefore a lower risk of toxicity. For example, the IC50 of antagonists on cancer cell growth is essential for determining the optimal dose which inhibits cancer cells while inducing less harmful systemic effects in the body.
BMPs for clinical use are produced using recombinant DNA technology (recombinant human BMPs; rhBMPs). Recombinant BMP-2 and BMP-7 are currently approved for human use. rhBMPs are used in oral surgeries. BMP-7 has also recently found use in the treatment of chronic kidney disease (CKD). BMP-7 has been shown in murine animal models to reverse the loss of glomeruli due to sclerosis. A 2022 study by researchers from the Mayo Clinic, Maastricht University, and Ethris GmBH, a biotech company that focuses on RNA therapeutics, found that chemically modified mRNA encoding BMP-2 promoted dosage-dependent healing of femoral osteotomies in male rats. The mRNA molecules were complexed within nonviral lipid particles, loaded onto sponges, and surgically implanted into the bone defects. They remained localized around the site of application. Compared to receiving rhBMP-2 directly, bony tissues regenerated after mRNA treatment displayed superior strength and less formation of massive callus.
Network Science, Part 5: Solvent-Accessible Surfaces AREAIMOL is a command line tool in the CCP4 Program Suite for calculating ASA. NACCESS solvent accessible area calculations. FreeSASA Open source command line tool, C library and Python module for calculating ASA. Surface Racer Oleg Tsodikov's Surface Racer program. Solvent accessible and molecular surface area and average curvature calculation. Free for academic use. ASA.py — a Python-based implementation of the Shrake-Rupley algorithm. Michel Sanner's Molecular Surface – the fastest program to calculate the excluded surface. pov4grasp render molecular surfaces. Molecular Surface Package — Michael Connolly's program. Volume Voxelator — A web-based tool to generate excluded surfaces. ASV freeware Analytical calculation of the volume and surface of the union of n spheres (Monte-Carlo calculation also provided). Vorlume Computing Surface Area and Volume of a Family of 3D Balls. GetArea Calculate solvent accessible surface area of proteins online. ProMS ProMS - Protein Molecular Surface Calculator
Sources: en.wikipedia.org
No. It is not approved as a therapeutic drug by major regulators. It is sold for research purposes in many settings, which is not the same as clinical approval.
It is classified among peptide hormones and related substances that are prohibited in sport. The ban reflects anti-doping rules rather than a judgment that the peptide is effective for performance enhancement.
Human studies are limited and have not produced consistent evidence of meaningful clinical benefit. Some early trials examined metabolic endpoints, but larger confirmatory trials are generally lacking.
AOD-9604 is a synthetic peptide fragment of human growth hormone, corresponding to amino acids 176-191. It is studied for potential effects on fat metabolism, but it is not approved as a drug in most countries. Its exact mechanism remains under investigation.