Lyophilized powder is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Last reviewed on 2025-11-21. Where a claim depends on a specific study, the study is described rather than over-claimed.
In its supplied form epitalon is a white to off-white powder, usually lyophilized and often hygroscopic. It dissolves readily in water and in aqueous buffers, and it is commonly handled as the acetate or trifluoroacetate salt to improve stability during purification and drying. The amide backbone is labile in aqueous media, so solutions are less durable than the dry solid. Handling notes in the chemical literature therefore emphasize keeping the powder dry, cool and shielded from light until it is dissolved.
Epitalon is a synthetic tetrapeptide whose sequence is alanine-glutamate-aspartate-glycine, written in single-letter code as AEDG. The four residues are joined by three peptide bonds, giving a linear backbone with no branching and no disulfide bridges. Its calculated molecular mass for the free form is approximately 390.3 daltons, a figure that rises when the compound is supplied as an acetate or trifluoroacetate salt. Because the chain is short, the molecule is defined entirely by its residue order rather than by any folded three-dimensional structure.
Epitalon appears in the literature primarily through a small number of research groups, most of them associated with the St. Petersburg Institute of Bioregulation and Gerontology. Publications describe cell culture experiments, animal studies, and a limited number of small human studies. Independent replication outside this network is sparse. As a result, reviews of the topic usually separate descriptive reports of observed effects from the question of whether those effects generalize, and they note the difficulty of comparing studies that use different preparations and endpoints.
Analytical characterization of epitalon relies on standard peptide methods. Reverse-phase high-performance liquid chromatography is used to assess purity, and mass spectrometry confirms identity by checking the observed mass against the expected value near 390 daltons. Amino acid analysis can verify composition. Because the peptide is short and hydrophilic, it elutes early on many reverse-phase columns, so method development often requires ion-pairing reagents to achieve adequate retention and resolution from related impurities.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Synthetic tetrapeptide | Four residues, linear chain |
| Residue sequence | Ala-Glu-Asp-Gly | Single-letter form AEDG |
| Calculated mass | 390.3 daltons | Value for the free, uncharged form |
| Appearance | White to off-white powder | Usually supplied lyophilized |
| Solubility | Freely soluble in water | Often handled as a salt form |
Laboratory-grade epitalon is typically supplied as a lyophilized powder. Purity is commonly assessed with reverse-phase high-performance liquid chromatography, often paired with mass spectrometry to confirm molecular identity. Amino acid analysis and peptide mapping can provide additional confirmation of sequence. Certificates of analysis for research materials frequently report purity above 95 percent, although the methods behind such figures vary between suppliers. The absence of a pharmacopeial monograph means that no single standardized assay defines the compound, so reported results depend on the analytical protocol chosen.
Storage recommendations center on limiting moisture, heat, and light. The dry powder is generally kept at minus 20 degrees Celsius, and some suppliers recommend minus 80 degrees for long-term archival. Once dissolved, solutions are usually aliquoted and frozen to avoid repeated freeze-thaw cycles, which can promote aggregation or degradation. Aqueous stability depends on pH and concentration, and buffered saline is often preferred over plain water for biological work. Stability data specific to epitalon remain limited, so general peptide-handling practices are applied by analogy rather than from product-specific validation.
Epitalon is a synthetic tetrapeptide with the sequence alanine-glutamate-aspartate-glycine, abbreviated AEDG. Its molecular formula is C14H22N4O9 and its calculated monoisotopic mass is approximately 390.35 daltons. The compound does not occur naturally as a free peptide; it is produced by solid-phase peptide synthesis. Because it contains two acidic residues and no basic residues, the neutral form carries a net negative charge at physiological pH. This charge profile influences how the peptide behaves in solution and during chromatographic analysis.
Purity assessment of peptide reagents normally relies on reversed-phase high-performance liquid chromatography. A gradient of acetonitrile in water with trifluoroacetic acid, paired with a C18 stationary phase, separates the target tetrapeptide from truncated sequences and deletion analogues. Detection at 214 nanometres exploits absorbance of the peptide backbone, since the molecule contains no aromatic residue. Results are expressed as a percentage of total peak area. Values above ninety-five percent are typical for research-grade material, although reporting conventions vary between suppliers.
Identity confirmation uses mass spectrometry, usually electrospray ionisation in positive mode or matrix-assisted laser desorption. The protonated free peptide produces a signal near three hundred and ninety-one daltons, while salt adducts shift that value slightly. Tandem mass spectrometry or amino acid analysis supplies sequence-level confirmation, which a single mass measurement cannot. Peptides containing aspartate can cyclise into succinimide intermediates that hydrolyse to isoaspartate isomers of identical mass. Because those isomers are difficult to separate chromatographically, identity and purity results carry more weight when interpreted together.
The compound is generally presented as a synthetic fragment of epithalamin, a pineal gland extract investigated in the former Soviet Union from the 1970s onward. Vladimir Khavinson and colleagues in Saint Petersburg developed short peptides modelled on such extracts, and epitalon became the most widely cited of those sequences. Most primary reports appeared in Russian-language journals or in proceedings with limited international circulation. Independent replication in laboratories outside that network remains sparse, and much repeated secondary material traces back to a small number of originating groups.
Laboratory work has examined effects on telomerase activity in cultured cells, on melatonin rhythms in animals, and on markers of oxidative stress. Some experiments report measurable changes while others show none, and the reported findings rest largely on small studies. The absence of large independent trials means the generality of these results is unresolved rather than settled. Review articles occasionally apply the label geroprotector, a term that reflects a research hypothesis about ageing rather than an established clinical finding.
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography with ultraviolet detection, frequently near 214 nanometers where the peptide bond absorbs. Mass spectrometry, most often with electrospray ionization, confirms the observed molecular mass and helps separate the intact peptide from truncated or modified forms. Amino acid analysis or tandem mass spectrometry can establish residue order. Purity is commonly quoted as an area percentage, yet such values are method-dependent, and comparisons between laboratories require matching column, gradient and detection wavelength.
Laboratory handling begins with dissolution of the lyophilized powder in water or a suitable aqueous buffer. The dry solid is the more stable form, so stock solutions are generally prepared only when required and kept cold afterwards. Repeated freezing and thawing of a solution is avoided because it encourages aggregation and gradual loss of the intact chain. Diluents and containers are selected to limit adsorption of a short peptide onto plastic surfaces and to reduce microbial growth in aqueous preparations.
== Chemistry == Bulevirtide is a 47-amino acid long lipopeptide with the following sequence: CH3(CH2)12CO-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-Trp-Asp-Phe-Asn-Pro-Asn-Lys-Asp-His-Trp-Pro-Glu-Ala-Asn-Lys-Val-Gly-NH2 (C13H27CO-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2)
=== Structure-activity experiments === When the 12-amino acid sequence of 'peptide 3'/CCL2 is aligned with the sequences of the other chemokines CCL3, CXCL8 and CXCL12 5 amino acids are conserved, Cys3, Asp5, Pro6, Trp10 and Gln12. In addition Val11 is also present in CCL3 and CXCL8. The corresponding 11th amino acid in CXCL12 is Ile. Ala4 in CCL2 is also present in CCL3 but the corresponding residue is Leu in CXCL8 and Ile in CXCL12. Inclusion of Leu at position 4 and Ile at position 11 (NH2-EICLDPKQKWIQ-OH) increased the inhibition potency of the peptide to 2-4μM. Removal of the first two residues from 'Peptide 3' (NH2-CADPKQKWVQ-OH) does not lower its BSCI potency. Peptide 3-Leu4, Ile11, the most potent BSCI peptide was chosen for further development. The first two amino acids were removed, and then according to the method of Jameson et al., the amino acid sequence was reversed and the amino acids replaced with D-amino acids. This combined transformation changes the orientation of the amides in the backbone but does not change the position of the amino acid sidechains. The peptide was then cyclised by adding a cysteine to the other end (HO-CLDPKQKWIQC-NH2), and oxidisation to form a disulfide bond to give NR58,3-14-3.
Note that the relation of the potential to the flow velocity is unaffected by this transformation: ∇Φ = ∇φ. The Bernoulli equation for unsteady potential flow also appears to play a central role in Luke's variational principle, a variational description of free-surface flows using the Lagrangian mechanics.
North American box turtles breathe continuously during locomotion, and the ventilation cycle is not coordinated with the limb movements. This is because they use their abdominal muscles to breathe during locomotion. The last species to have been studied is the red-eared slider, which also breathes during locomotion, but takes smaller breaths during locomotion than during small pauses between locomotor bouts, indicating that there may be mechanical interference between the limb movements and the breathing apparatus. Box turtles have also been observed to breathe while completely sealed up inside their shells.
An individual or juridical or other body authorized under applicable law to consent, on behalf of a prospective subject, to the subject's participation in the clinical trial. (ICH E6) Levels of evidence
Sources: en.wikipedia.org
The fruit is a hairy pod that grows in clusters of three to five, each pod is 3–8 cm (1–3 in) long and usually contains two to four (rarely more) seeds 5–11 mm in diameter. Soybean seeds come in a wide variety of sizes and hull colors such as black, brown, yellow, and green. Variegated and bicolored seed coats are also common.
amphoteric Also amphiprotic. (of a chemical species) Tending to behave both as an acid and as a base, depending upon the medium in which the species is situated; e.g. sulfuric acid (H2SO4) is a strong acid in water but behaves more like a base in superacids.
Dr Christopher John Kent. Organist. For services to Music and Musicology. Azam Ahmed Khan. Executive Officer, Department for Work and Pensions and Founder, The Akhirah Team. For Charitable Services. William James David King. For services to Association Football in Northern Ireland. Gwendoline May Kingdon. For services to the community in South Molton, Devon. Elizabeth McDonald Kinnear. Volunteer, Guide Dogs Perth and District Branch. For services to Guide Dogs for the Blind in Perthshire. Juan Kotze. OCS Contracted Security Lead and Head of VIP Relations, Ministry of Justice. For Public Service. Kathleen Louisa Kynaston. Lately Chair, Shrewsbury Amateur Swimming Club. For services to Swimming and to the community in Shropshire. Rachael Isabel Lake. For services to the community in Walton on Thames, Surrey. Marino Teddy Michel Latour. Designated Safeguarding Professional, NHS South West London Integrated Care Board. For services to Safeguarding Adults. Amanda Jayne Lear. Enforcement Case Manager, Department for Work and Pensions. For services to the community in Moreton, Merseyside. Diana Rosemary Lee. For services to the community in Collingham, West Yorkshire. Frances Christina Lee. For services to the community in Acocks Green, West Midlands. Stephen Roger Lees JP. For services to the communities in Himley, Swindon and South Staffordshire. Morag Linda Lightning. Vice Chair, Turriff and District Community Council. For services to the community in Turriff, Aberdeenshire, particularly during Covid-19. Henry Lillystone. Fixtures Secretary, Leicestershire Foxes Sunday League.
As the complexity of proteolytic networks was uncovered, more thorough descriptions of the degradome and ways to study it became necessary. In 2007, Dr. Overall updated the field with a review co-authored by Dr. Carl Blobel detailing how advanced methods were revolutionizing protease-substrate discovery. They described the process of linking proteases to their substrates on a step by step process, beginning with biochemical and proteomic discovery, validation using cellular based assays, and progressing to whole organism levels using animal models. More recently, as technology and techniques have advanced, the Overall Lab and others have continued to direct the field using more powerful and quantitative techniques.
Sources: en.wikipedia.org
=== February === 2 February – Auckland Transport raises fares on buses, trains and ferries by 5.2% and ends the 10% off-peak discount. 3 February – The Tāhuna Glenorchy area of Central Otago is certified a Dark Sky Sanctuary, the 23rd such designation in the world and fifth in New Zealand. 4 February – 900 private sector laboratory workers strike to protest poor conditions and a lack of pay parity with their public sector counterparts. 5 February: The New Zealand Government confirms it will invest between NZ$100–150 million in upgrading State Highway 76 in Christchurch. It is announced that New Zealand's unemployment rate reaches 5.1%, the highest level since September 2020. Several Māori leaders and attendees protest against several government ministers including David Seymour, Paul Goldsmith and Shane Jones during a pōwhiri leading up to Waitangi Day. Seymour's speech is disrupted while Jones threatens to cut government funding to the Waitangi National Trust. 6 February: Prime Minister Christopher Luxon attends Waitangi Day celebrations at Ngāi Tahu's Ōnuku marae in Akaroa. The town hall in Roxburgh, Otago, which included the country's longest-running cinema, is destroyed by fire. The former building for New Zealand's sole Jewish school "Kadimah School" is vandalised with antisemitic graffiti referencing the Gaza war. 7 February: Health New Zealand chief executive Margie Apa resigns four months before the end of her contract. Taupō experiences heavy showers and thunderstorms, resulting in surface flooding and power outages.
== Other uses == French Defence (Encyclopaedia of Chess Openings code) Combat 18, a British neo-Nazi organisation 18th century (1701–1800 AD) Android 18, character from Dragon Ball Franchise Bill C-18, Canada's Online News Act
In 1946, the Atomic Bomb Casualty Commission (ABCC) was established by the National Research Council of the National Academy of Sciences by order of U.S. President Harry S. Truman to study the long-term effects of radiation on survivors of the atomic bombings. In 1975, the ABCC was replaced by the Radiation Effects Research Foundation (RERF). Organizations such as the United Nations Scientific Committee on the Effects of Atomic Radiation (UNSCEAR), founded in 1955, and the National Academy of Sciences - Advisory Committee on the Biological Effects of Ionizing Radiation (BEIR Committee), founded in 1972, analyze the effects of radiation exposure on humans on the basis of atomic bomb victims who have been examined and, in some cases, medically monitored for decades. They determine the course of the mortality rate as a function of the age of the radiation victims in comparison with the spontaneous rate, and also the dose-dependency of the number of additional deaths. To date, 26 UNSCEAR reports have been published and are available online, most recently in 2017 on the effects of the Fukushima nuclear accident. By 1949, Americans felt increasingly threatened by the possibility of nuclear war with the Soviet Union and sought ways to survive a nuclear attack. The U.S. Federal Civil Defense Administration (USFCDA) was created by the government to educate the public on how to prepare for such an attack. In 1951, with the help of this agency, a children's educational film was produced in the U.S.
== Imaging Mass Cytometry (IMC) == Imaging mass cytometry (IMC) is a relatively new imaging technique, emerged from previously available CyTOF technology (cytometry by time of flight), that combines mass spectrometry with UV laser ablation to generate pseudo images of tissue samples. This approach adds spatial resolution to the data, which enables simultaneous analysis of multiple cell markers at subcellular resolution and their spatial distribution in tissue sections. The IMC approach, in the same way as CyTOF, relies on detection of metal-tagged antibodies using time-of-flight mass spectrometry, allowing for quantification of up to 40 markers simultaneously.
=== The Sean Duffy series === The Cold Cold Ground (Serpent's Tail) 2012 ISBN 978-1616147167 I Hear the Sirens in the Street (Serpent's Tail) 2013 ISBN 978-1616147877 In the Morning I'll Be Gone (Serpent's Tail) 2014 ISBN 978-1616148775 Gun Street Girl (Serpent's Tail) 2015 ISBN 978-1633880009 Rain Dogs (Serpent's Tail) 2016 ISBN 978-1633881303 Police at the Station and They Don't Look Friendly (Serpent's Tail) 2017 ISBN 1781256926 The Detective Up Late (Blackstone) 2023 Hang On St Christopher (Blackstone) 2025 The Ghosts Of Saturday Night TBD Two more Sean Duffy novels to be published by Blackstone Publishing On a blog post dated July 15, 2021, on his official site, McKinty explains that the 7th Sean Duffy novel (The Detective Up Late) may be out in late 2022. He states that The Detective Up Late is in fact finished and Book 8 (Hang On St Christopher) is pretty much done.
Sources: en.wikipedia.org
The peptide contains four residues in the order alanine, glutamate, aspartate and glycine, abbreviated AEDG. The chain is linear and held together by three peptide bonds. Its calculated mass for the uncharged free form is about 390.3 daltons.
Epithalamin refers to a crude preparation derived from bovine pineal tissue, which contains many components. Epitalon is a single synthetic tetrapeptide identified from that material and produced by chemical synthesis. The two names are sometimes confused because early reports treated the synthetic peptide as an active fragment of the extract.
It has been registered for clinical use in Russia, where it is associated with a small family of short peptides. In most other jurisdictions it is not an approved medicine and is traded as a research chemical. Regulatory status varies by country and changes over time.
Identity is normally confirmed by mass spectrometry, which checks the measured mass against the expected value near 390 daltons. Reverse-phase high-performance liquid chromatography is used alongside it to assess purity. Amino acid analysis can provide additional composition data.